Return to main results Retrieve Phyre Job Id

Job DescriptionASR85474.1_RusA-like_resolvase_[Mycobacterium_phage_Cain]
Confidence19.97%DateMon Jun 7 16:50:03 BST 2021
Rank5Aligned Residues24
% Identity63%Templatec3vh5D_
PDB info PDB header:dna binding proteinChain: D: PDB Molecule:cenp-x; PDBTitle: crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-2 s/cenp-x heterotetrameric complex, crystal form i
Resolution2.40 Å
Model Dimensions (Å)X:16.298 Y:21.882 Z:22.529

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.... .....40....
Predicted Secondary structure  .............
Query SS confidence 













. . . . . . . . . . . . .









Query Sequence  VAEAAARAAEHAKA. . . . . . . . . . . . . AAAELLLDMV
Query Conservation                .............          
Alig confidence 













.............









Template Conservation 
 


 

   
       

 





 






 
Template Sequence  VREAAARAARQAQAEDLEKVDIEHVEKVLPQLLLDFV
Template Known Secondary structure  TT
SS



Template Predicted Secondary structure 







Template SS confidence 




































   44.....50.........60.........70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D