Return to main results Retrieve Phyre Job Id

Job DescriptionASR85474.1_RusA-like_resolvase_[Mycobacterium_phage_Cain]
Confidence5.13%DateMon Jun 7 16:50:03 BST 2021
Rank34Aligned Residues25
% Identity28%Templatec2rsyB_
PDB info PDB header:transferase/signaling proteinChain: B: PDB Molecule:phosphoprotein associated with glycosphingolipid-enriched PDBTitle: solution structure of the sh2 domain of csk in complex with a2 phosphopeptide from cbp
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100........
Predicted Secondary structure 

























Query SS confidence 





























Query Sequence  APQGSKDFMGFKKAPEGSPPGTRGPAILKE
Query Conservation 





 
 
  
    
     
   
 
Alig confidence 















.....








Template Conservation 



 

 

 




.....



 



Template Sequence  GPLGSKRFSSLSYKSR. . . . . EEDPTLTEE
Template Known Secondary structure 














T.....TT
TT

Template Predicted Secondary structure 








.....






Template SS confidence 





























   284.....290......... 300........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D