Return to main results Retrieve Phyre Job Id

Job DescriptionASR85416.1_tail_terminator_[Mycobacterium_phage_Cain]
Confidence16.84%DateMon Jun 7 16:50:02 BST 2021
Rank10Aligned Residues42
% Identity45%Templated2dbsa1
SCOP infoTTHC002-like TTHC002-like TTHC002-like
Resolution2.10
Model Dimensions (Å)X:33.587 Y:34.062 Z:33.759

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60..
Predicted Secondary structure 




























Query SS confidence 



























































Query Sequence  VLVPPVGPLTAARRYLLDELAARTNPLPVSQVVPEGSPTSYTLLSRPGTSTDVFLQHSLI
Query Conservation   


 



 












 






 



 



 






 




 
 

Alig confidence 


















..........













..........






Template Conservation 

















 ..........













..........






Template Sequence  VLLPLDEPEVAAQALAWAX. . . . . . . . . . EAPNPEGWPSVYAL. . . . . . . . . . FLQGRPI
Template Known Secondary structure  TT
..........S


SSSS
..........TT
Template Predicted Secondary structure 



..........







..........



Template SS confidence 



























































   35....40.........50... ......60....... ..70....
 
   63.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  RL
Query Conservation 
 
Alig confidence 

Template Conservation 

Template Sequence  RL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   75.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D