Return to main results Retrieve Phyre Job Id

Job DescriptionASR85416.1_tail_terminator_[Mycobacterium_phage_Cain]
Confidence9.05%DateMon Jun 7 16:50:02 BST 2021
Rank16Aligned Residues25
% Identity32%Templatec3lkxB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:nascent polypeptide-associated complex subunit alpha; PDBTitle: human nac dimerization domain
Resolution2.50 Å
Model Dimensions (Å)X:18.852 Y:30.672 Z:26.364

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100.........110.........120..
Predicted Secondary structure 





















Query SS confidence 





























Query Sequence  IVVPAAADDPGGEVWITGAKHEFGPASLDD
Query Conservation 

 
       
 





 
  






Alig confidence 















.....








Template Conservation 
  






 
 


.....








Template Sequence  ITKPDVYKSPASDTYI. . . . . VFGEAKIED
Template Known Secondary structure  S

TTSS
.....S

Template Predicted Secondary structure 







.....




Template SS confidence 





























   47..50.........60.. .......70.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D