Return to main results Retrieve Phyre Job Id

Job DescriptionASR85416.1_tail_terminator_[Mycobacterium_phage_Cain]
Confidence2.86%DateMon Jun 7 16:50:02 BST 2021
Rank85Aligned Residues40
% Identity35%Templatec1gjjA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:lap2; PDBTitle: n-terminal constant region of the nuclear envelope protein2 lap2
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70....
Predicted Secondary structure 

























Query SS confidence 
























































Query Sequence  LLDELAARTNPLPVSQVVPEGSPTSYTLLSRPGTSTDVFLQHSLIRLRTFDDDLVRL
Query Conservation 







 






 



 



 






 




 
 


 



 
 


Alig confidence 














.................
























Template Conservation 


 
 
 

 

  .................   




 

   
   
 

  
Template Sequence  LKSELVANNVTLPAG. . . . . . . . . . . . . . . . . EQRKDVYVQLYLQHLTARNRDVTEL
Template Known Secondary structure  TT



SS.................

BBTTT



Template Predicted Secondary structure 







.................







Template SS confidence 
























































   16...20.........30 .........40.........50.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D