Return to main results Retrieve Phyre Job Id

Job DescriptionASR85460.1_hypothetical_protein_SEA_CAIN_61_[Mycobacterium_phage_Cain]
Confidence3.02%DateMon Jun 7 16:50:03 BST 2021
Rank93Aligned Residues29
% Identity48%Templatec6z0hA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:triggering receptor expressed on myeloid cells 2; PDBTitle: structure of trem2 transmembrane helix k186a variant in dpc micelles
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.
Predicted Secondary structure 






Query SS confidence 




































Query Sequence  PFPPLDSDQAAQLSALLDLASAKVHALAAAHERYQAA
Query Conservation 




































Alig confidence 



........
























Template Conservation 



........
























Template Sequence  PFPP. . . . . . . . TSILLLLACIFLIAILAASALWAAA
Template Known Secondary structure 


........
Template Predicted Secondary structure 



........
Template SS confidence 




































   910.. .......20.........30.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D